9idZddlmZddlZddlZddlZddlZddlZddlZddl Z ddl Z ddl m Z ddlm Z ddlmZddlZddlZddlmZmZddlmZdd lmZmZmZdd lmZmZdd lmZdd l m!Z!m"Z"d dl#m$Z$d dl%m&Z&m'Z'm(Z(m)Z)m*Z*d dl+m,Z,d dl-m.Z.m/Z/m0Z0m1Z1m2Z2d dl3m4Z4m5Z5m6Z6m7Z7d dl8m9Z9d dl:m;Z;GddZGddZ?y)z Flask-Limiter Extension ) annotationsN) defaultdict)partial)overload) RateLimitItem WindowStats)ConfigurationError) MemoryStorageStoragestorage_from_string) STRATEGIES RateLimiter) OrderedSet) http_date parse_date)request_context)ApplicationLimitLimit MetaLimit RouteLimit RuntimeLimit) LimitManager)CallablePRSequencecast)MAX_BACKEND_CHECKS ConfigVarsExemptionScope HeaderNames)RateLimitExceeded)get_qualified_nameceZdZUdZded<ded<ded<ded< dd Zedd Zedd Zedd Z edd Z y) RequestLimitzJ Provides details of a rate limit within the context of a request rlimitstrkeyboolbreachedsharedctj||_||_||_|j ||_||_||_d|_ yN) weakrefproxy extensionr' request_argskey_forr)r+r,_window)selfr1r'r2r+r,s K/var/www/html/venv/lib/python3.12/site-packages/flask_limiter/_extension.py__init__zRequestLimit.__init__BsJ6=]]95M ( 5==,/   +/ cJtt|jjSr.)rrr1limiterr5s r6r:zRequestLimit.limiterRsK!7!788r8c|js6|jj|jg|j|_|jSr.)r4r:get_window_statsr'r2r;s r6windowzRequestLimit.windowVs:||84<<88XdFWFWXDL||r8c8t|jddzS)z/Timestamp at which the rate limit will be resetrr)intr>r;s r6reset_atzRequestLimit.reset_at]s4;;q>A%&&r8c |jdS)z&Quantity remaining for this rate limitr)r>r;s r6 remainingzRequestLimit.remainingcs{{1~r8N) r1Limiterr'rr2z list[str]r+r*r,r*returnNonerEr)rEr)rEr@) __name__ __module__ __qualname____doc____annotations__r7propertyr:r>rArCr8r6r&r&1s  HN L000 0  0  0 0 99 '' r8r&ceZdZUdZded<ej eZded<ej e Z ded<ej e Z d ed <d d Z y) LimiterContextNRequestLimit | Noneview_rate_limit)default_factorylist[RequestLimit]view_rate_limitszdict[RuntimeLimit, list[str]]conditional_deductionszOrderedSet[RuntimeLimit] seen_limitscd|_|jj|jj|jjyr.)rRrUclearrVrWr;s r6resetzLimiterContext.resetqs@# ##% ##))+  r8rErF)rHrIrJrRrL dataclassesfieldlistrUdictrVrrWrZrNr8r6rPrPjs]+/O(/+<;+<+d"Zd,d?d#Zy)@rDa~ The :class:`Limiter` class initializes the Flask-Limiter extension. :param key_func: a callable that returns the domain to rate limit by. :param app: :class:`flask.Flask` instance to initialize the extension with. :param default_limits: a list of strings, callables returning strings denoting default limits or :class:`Limit` instances to apply to all routes that are not explicitely decorated with a limit. :ref:`ratelimit-string` for more details. :param default_limits_per_method: whether default limits are applied per method, per route or as a combination of all method per route. :param default_limits_exempt_when: a function that should return True/False to decide if the default limits should be skipped :param default_limits_deduct_when: a function that receives the current :class:`flask.Response` object and returns True/False to decide if a deduction should be made from the default rate limit(s) :param default_limits_cost: The cost of a hit to the default limits as an integer or a function that takes no parameters and returns an integer (Default: ``1``). :param application_limits: a list of strings, callables returning strings for limits or :class:`ApplicationLimit` that are applied to the entire application (i.e a shared limit for all routes) :param application_limits_per_method: whether application limits are applied per method, per route or as a combination of all method per route. :param application_limits_exempt_when: a function that should return True/False to decide if the application limits should be skipped :param application_limits_deduct_when: a function that receives the current :class:`flask.Response` object and returns True/False to decide if a deduction should be made from the application rate limit(s) :param application_limits_cost: The cost of a hit to the global application limits as an integer or a function that takes no parameters and returns an integer (Default: ``1``). :param headers_enabled: whether ``X-RateLimit`` response headers are written. :param header_name_mapping: Mapping of header names to use if :paramref:`Limiter.headers_enabled` is ``True``. If no mapping is provided the default values will be used. :param strategy: the strategy to use. Refer to :ref:`ratelimit-strategy` :param storage_uri: the storage location. Refer to :data:`RATELIMIT_STORAGE_URI` :param storage_options: kwargs to pass to the storage implementation upon instantiation. :param swallow_errors: whether to swallow any errors when hitting a rate limit. An exception will still be logged. default ``False`` :param fail_on_first_breach: whether to stop processing remaining limits after the first breach. default ``True`` :param on_breach: a function that will be called when any limit in this extension is breached. If the function returns an instance of :class:`flask.Response` that will be the response embedded into the :exc:`RateLimitExceeded` exception raised. :param meta_limits: a list of strings, callables returning strings for limits or :class:`MetaLimit` that are used to control the upper limit of a requesting client hitting any configured rate limit. Once a meta limit is exceeded all subsequent requests will raise a :class:`~flask_limiter.RateLimitExceeded` for the duration of the meta limit window. :param on_meta_breach: a function that will be called when a meta limit in this extension is breached. If the function returns an instance of :class:`flask.Response` that will be the response embedded into the :exc:`RateLimitExceeded` exception raised. :param in_memory_fallback: a list of strings or callables returning strings denoting fallback limits to apply when the storage is down. :param in_memory_fallback_enabled: fall back to in memory storage when the main storage is down and inherits the original limits. default ``False`` :param retry_after: Allows configuration of how the value of the `Retry-After` header is rendered. One of `http-date` or `delta-seconds`. :param key_prefix: prefix prepended to rate limiter keys and app context global names. :param request_identifier: a callable that returns the unique identity the current request. Defaults to :attr:`flask.Request.endpoint` :param enabled: Whether the extension is enabled or not NT)appdefault_limitsdefault_limits_per_methoddefault_limits_exempt_whendefault_limits_deduct_whendefault_limits_costapplication_limitsapplication_limits_per_methodapplication_limits_exempt_whenapplication_limits_deduct_whenapplication_limits_costheaders_enabledheader_name_mappingstrategy storage_uristorage_optionsswallow_errorsfail_on_first_breach on_breach meta_limitson_meta_breachin_memory_fallbackin_memory_fallback_enabled retry_after key_prefixrequest_identifierenabledc||_tjd|_||_d|_||_||_||_||_ | |_ | |_ | |_ | |_ g|_|xs|xrt|dkD|_i|_i|_g|_| |_|xsi|_||_||_||_|xsi|_||_||_||_||_||_||_||_ |rV|Dcgc]J}tC|tDs'tE||j<djG|n|jG|Lc}ng}|rK|Dcgc]?}tC|tDstI|djG|n|jG|Ac}ng}|rJ|Dcgc]>}tC|tDstK|jG|n|jG|@c}ng|_&|rI|D]D}|jjOtC|tDstE||j<n|Fd|_(d|_)d|_*d|_+d|_,t[jZ|_.t_|_0|jjctjdtg||ii|j"|j$|_4|r|jk|yycc}wcc}wcc}w) Nz flask-limiterFr)limit_provider key_function finalized)r~r)r~r~r)rhrcdecorated_limitsblueprint_limitsroute_exemptionsblueprint_exemptions)6rblogging getLoggerloggerr| initialized_default_limits_per_method_default_limits_exempt_when_default_limits_deduct_when_default_limits_cost_application_limits_per_method_application_limits_exempt_when_application_limits_deduct_when_application_limits_cost_in_memory_fallbacklen_in_memory_fallback_enabled_route_exemptions_blueprint_exemptions_request_filters_headers_enabled_header_mapping _retry_after _strategy _storage_uri_storage_options_swallow_errors_fail_on_first_breach _on_breach_on_meta_breach _key_func _key_prefix_request_identifier isinstancerbindrr _meta_limitsappend_storage_limiter _storage_dead_fallback_limiter_Limiter__check_backend_counttime_Limiter__last_check_backendset_marked_for_limiting addHandler NullHandlerr limit_managerinit_app) r5key_funcrbrcrdrerfrgrhrirjrkrlrmrnrorprqrrrsrtrurvrwrxryrzr{r|r'_default_limits_application_limitss r6r7zLimiter.__init__s3@''8   *C'+E(+E($7!.K+/M,/M,(?%#% +E,  >3'9#:Q#> (=?@B":< /28b'!' / 52-%9"#-!%#5 , "%/ #(!%#$t*ZZ% &  2"0 "%/ !#(#$t*ZZ% &  .)   "%/#($t*ZZ% &   + ((// &eU3 ',%)^^   )- ,0 "59%&"$(IIK!.1e! w2245)2*!33!%!;!;    MM#  Q   sAL"AL1AL cb|j}|jtj|j|_|jsy|j .t |jtjd|_|jxs|jtj|_ |jxs|jtj|_ |jxs |jtjd|_ |j.t |jtj d|_|j".t |jtj$d|_|j&.t |jtj(d|_|j*j-|jtj.i|jtj0d}|s#|j2st5j6dd}t9t:t=|j2xs|fi|j*|_|j@xs |jtjBd|_ |j@tDvrtGd|j@ztE|j@|j>|_$tJjL|jNjtJjL|jtjPtJjLjRtJjT|jNjtJjT|jtjVtJjTjRtJjX|jNjtJjX|jtjZtJjXjRtJj\|jNjtJj\|jtj^tJj\jRi|_'|j`xs|jtjb|_0|jdxs |jtjfd |_2|jhxs!|jtjjd |_4|jtjld}|jnxs |jtjpd|_7|jr.t |jtjtd|_9|jvxs|jtjx|_;|jzxs|jtj||_=|j~jsd|rb|j~jt||jr|jv|jz|jn j|gn|j~j}|D]Z}|jr|jn|_E|jr|_F|jv|_G|jz|_Hd|_D\|j~j||jtjd}|j~jso|rm|j~jt||j|j |j|j|j j|gn|j~j}|D]Z}|jr|j|_E|j |_F|j|_G|j|_Hd|_D\|j~j||jtjd} |jsO| rMt| ts&t| |j j|n| j|g|_O|jxs |jtjd|_R|jxs |jtjd|_T|j||j@||jjdtvr_|j|j|jttj||j|j|jdj|d|_by)zJ :param app: :class:`flask.Flask` instance to rate limit. NFrTa Using the in-memory storage for tracking rate limits as no storage was explicitly specified. This is not recommended for production use. See: https://flask-limiter.readthedocs.io#configuring-a-storage-backend for documentation about configuring the storage backend.z memory://z fixed-windowz!Invalid rate limiting strategy %srac>tjjxsdS)Nra)flaskrequestendpointrNr8r6z"Limiter.init_app..s5==3I3I3ORr8)r~ per_method exempt_when deduct_whencost)r~rrrrrrr:)cconfig setdefaultr ENABLEDr|rr*getDEFAULT_LIMITS_PER_METHODrDEFAULT_LIMITS_EXEMPT_WHENrDEFAULT_LIMITS_DEDUCT_WHENrDEFAULT_LIMITS_COSTrSWALLOW_ERRORSrFAIL_ON_FIRST_BREACHrHEADERS_ENABLEDrupdateSTORAGE_OPTIONS STORAGE_URIrwarningswarnrr r rrSTRATEGYr r rr"RESETr HEADER_RESETvalue REMAININGHEADER_REMAININGLIMIT HEADER_LIMIT RETRY_AFTERHEADER_RETRY_AFTERrHEADER_RETRY_AFTER_VALUEr KEY_PREFIXrREQUEST_IDENTIFIERAPPLICATION_LIMITSrAPPLICATION_LIMITS_COSTrAPPLICATION_LIMITS_PER_METHODrAPPLICATION_LIMITS_EXEMPT_WHENrAPPLICATION_LIMITS_DEDUCT_WHENrrset_application_limitsrrrrrrrDEFAULT_LIMITSrset_default_limitsrr META_LIMITSrrrr ON_BREACHrON_META_BREACH_Limiter__configure_fallbacks extensionsrbefore_request_check_request_limit after_requestrrD_Limiter__inject_headersteardown_request_Limiter__release_contextaddr) r5rbrstorage_uri_from_config app_limitsgroup conf_limitsdefault_limit_groups default_grouprus r6rzLimiter.init_appFs((););T\\J ||   * * 2.2 :??G/D +,0+K+K, vzz  1 1P (,0+K+K, vzz  1 1P (%)$=$=%   * *AB !    '#' :3L3Le(T#UD  % % -)-fjj9X9XZ^._)`D &  ($(J4N4NPU)V$WD ! $$VZZ 0J0JB%OP"(**Z-C-CT"J&$$ O '2 #  !!<%< @D@U@U   a6+<+> +$%H4>>%YZ Z"4>>24==A    t3377!! :22K4E4E4K4KL   ! !4#7#7#;#;%% :66 8M8M8S8ST$   t3377!! :22K4E4E4K4KL   # #T%9%9%=%='' :88+:Q:Q:W:WX& $!--`J<_<_1`++Tvzz*:O:OQS/T#'#;#;$ vzz  ) )+O@  ZZ = =tD (,(E(E)   . .J %  . . 626 :CCUK3D /04/S/S0 W]WaWa  5 5X ,04/S/S0 W]WaWa  5 5X ,!!55*    5 5$'1#'#F#F$($H$H$($H$H!::  d4j ++??J# +!%!>!>EJ'+'J'JE$(,(L(LE%(,(L(LE%&*EO  +    5 5j Ajj!:!:DA !!11k    1 1'2%)^^#'#B#B$($D$D$($D$D!66 d4j  $(#5#5#E#E !5 3 $..)-)B)BM&/3/N/NM,040P0PM-040P0PM-.2M+  3    1 12F Gjj!7!7>   [ "+y9 #.!%$t* %%d+ !D //SVZZ 8L8Ld-S#33bvzz*B[B[]a7b ""37 s~~00CEB B   t88 9   gg&>&>E F  !7!7 8 y!%%d+r8ct}t|dstt|_t t ttf|j|S)aE The context is meant to exist for the lifetime of a request/response cycle per instance of the extension so as to keep track of any state used at different steps in the lifecycle (for example to pass information from the before request hook to the after_request hook) :meta private: _limiter_request_context)rhasattrrrPrrr_rD)r5ctxs r6contextzLimiter.contextsQs67+6~+FC ( .( )  ( (   r8Fr) rrmethods error_messageroverride_defaultsrrtrscoperuc Pt|||xs |jd| ||||||| | | S)a Decorator to be used for rate limiting individual routes or blueprints. :param limit_value: rate limit string or a callable that returns a string. :ref:`ratelimit-string` for more details. :param key_func: function/lambda to extract the unique identifier for the rate limit. :param per_method: whether the limit is sub categorized into the http method of the request. :param methods: if specified, only the methods in this list will be rate limited (default: ``None``). :param error_message: string (or callable that returns one) to override the error message used in the response. :param exempt_when: function/lambda used to decide if the rate limit should skipped. :param override_defaults: whether the decorated limit overrides the default limits (Default: ``True``). .. note:: When used with a :class:`~flask.Blueprint` the meaning of the parameter extends to any parents the blueprint instance is registered under. For more details see :ref:`recipes:nested blueprints` :param deduct_when: a function that receives the current :class:`flask.Response` object and returns True/False to decide if a deduction should be done from the rate limit :param on_breach: a function that will be called when this limit is breached. If the function returns an instance of :class:`flask.Response` that will be the response embedded into the :exc:`RateLimitExceeded` exception raised. :param cost: The cost of a hit or a function that takes no parameters and returns the cost as an integer (Default: ``1``). :param scope: a string or callable that returns a string for further categorizing the rate limiting scope. This scope is combined with the current endpoint of the request. Changes - .. versionadded:: 2.9.0 The returned object can also be used as a context manager for rate limiting a code block inside a view. For example:: @app.route("/") def route(): try: with limiter.limit("10/second"): # something expensive except RateLimitExceeded: pass Fr~r:rr,rrrrrrrrtrrurr) r5 limit_valuerrrrrrrrtrrrus r6r'z Limiter.limitsEz&!3T^^!'#/##  r8) rrrrrrrrtrruc Pt|||xs |jd||||||| | | | S)a decorator to be applied to multiple routes sharing the same rate limit. :param limit_value: rate limit string or a callable that returns a string. :ref:`ratelimit-string` for more details. :param scope: a string or callable that returns a string for defining the rate limiting scope. :param key_func: function/lambda to extract the unique identifier for the rate limit. :param per_method: whether the limit is sub categorized into the http method of the request. :param methods: if specified, only the methods in this list will be rate limited (default: ``None``). :param error_message: string (or callable that returns one) to override the error message used in the response. :param function exempt_when: function/lambda used to decide if the rate limit should skipped. :param override_defaults: whether the decorated limit overrides the default limits. (default: ``True``) .. note:: When used with a :class:`~flask.Blueprint` the meaning of the parameter extends to any parents the blueprint instance is registered under. For more details see :ref:`recipes:nested blueprints` :param deduct_when: a function that receives the current :class:`flask.Response` object and returns True/False to decide if a deduction should be done from the rate limit :param on_breach: a function that will be called when this limit is breached. If the function returns an instance of :class:`flask.Response` that will be the response embedded into the :exc:`RateLimitExceeded` exception raised. :param cost: The cost of a hit or a function that takes no parameters and returns the cost as an integer (default: ``1``). Trr) r5rrrrrrrrrrtrrus r6 shared_limitzLimiter.shared_limitSsEX&!3T^^!'#/##  r8flagscyr.rNr5objr s r6exemptzLimiter.exemptsr8cyr.rNr s r6rzLimiter.exemptsr8cyr.rN)r5r s r6rzLimiter.exempts r8ct|tjr(|jj |j ||S|r'|jj t|||Stj|j|S)a Mark a view function or all views in a blueprint as exempt from rate limits. :param obj: view function or blueprint to mark as exempt. :param flags: Controls the scope of the exemption. By default application wide limits, defaults configured on the extension and meta limits are opted out of. Additional flags can be used to control the behavior when :paramref:`obj` is a Blueprint that is nested under another Blueprint or has other Blueprints nested under it (See :ref:`recipes:nested blueprints`) The method can be used either as a decorator without any arguments (the default flags will apply and the route will be exempt from default and application limits:: @app.route("...") @limiter.exempt def route(...): ... Specific exemption flags can be provided at decoration time:: @app.route("...") @limiter.exempt(flags=ExemptionScope.APPLICATION) def route(...): ... If an entire blueprint (i.e. all routes under it) are to be exempted the method can be called with the blueprint as the first parameter and any additional flags:: bp = Blueprint(...) limiter.exempt(bp) limiter.exempt( bp, flags=ExemptionScope.DEFAULT|ExemptionScope.APPLICATION|ExemptionScope.ANCESTORS ) r ) rr Blueprintradd_blueprint_exemptionnameadd_route_exemptionr$ functoolsrrr s r6rzLimiter.exemptsud c5?? +    6 6sxx G      2 23Ec3JE R $$T[[> >r8c<|jj||S)a Decorator to mark a function as a filter to be executed to check if the request is exempt from rate limiting. :param fn: The function will be called before evaluating any rate limits to decide whether to perform rate limit or skip it. )rr)r5fns r6request_filterzLimiter.request_filters $$R( r8c|j}|jtjd}|jtjd}|j s1|r/t ||jdddj|g|_|js!|xst|j dkD|_ |jr-t|_ t||j|_yy)NFr)r~rrrrr)rrr IN_MEMORY_FALLBACK_ENABLEDIN_MEMORY_FALLBACKrrrrrrr _fallback_storager r)r5rbrorfallback_enabledfallback_limitss r6__configure_fallbackszLimiter.__configure_fallbackss!::j&K&KUS **Z%B%BDI''O#2!%$  $t*(D $///?/d3tG_G_C`cdCdD ,  + +%2_D "%/%9$:P:P%QD " ,r8c|jtkDrd|_tj|jz t d|jkDr/tj|_|xjdz c_yy)NrrTF)rrrrpowr;s r6__should_check_backendzLimiter.__should_check_backend sd  % %(: :)*D & 99;22 2SDs4|j@jCdd|_|jE|}n*|jFr|j@jIdn|Yd}~|Sd}~wwxYw)Nz Retry-Afterz http-dateBRate limit storage unreachable - falling back to in-memory storageTz5Failed to update rate limit headers. Swallowing error)%&_Limiter__check_conditional_deductionsr-r|rrrAheadersrr"rr(r'amountrrCrrrrr@rdatetimemktime timetuplemaxrrrrr6rrrr)rrr7)r5r8 header_limitrAexisting_retry_after_headerryes r6__inject_headerszLimiter.__inject_headerszsN ++H5)) <)>? ../  $$T%9%9+:K:K%LcRZm\/7.>.>.B.B=.Q+.:DN3EK #*&*iikC8S4T&T !+x/@/@A&*kk+2G2G2I&J "3{#3X>H  $$(()@)@A,, ;"(+ DIIK!78.x 33DH++ --S  s G>I KA6KKct| xsR|jxr |j xs5|jdddk(xst d|j DS)N.staticc3*K|] }| ywr.rN).0rs r6 z4Limiter.__check_all_limits_exempt..s8B248s)r*r|rsplitanyr)r5rs r6__check_all_limits_exemptz!Limiter.__check_all_limits_exemptsfL 9LL5T%5%56 9~~c"2&(2 98$"7"788   r8c|r|}n=tjjj|xsdd}|r t |nd}|j |rgS||j vxs|jj|xsd}g}|jr|jr|r||j vrn|jrP|jrD|jjr*|jjdd|_ d|_n%t#t%j&|j(}|r|S|jj+tj|||||\} } t-| |j.j0z } |j.j0j3| t#| t#| zS)NrazRate limit storage recoveredFr)r current_appview_functionsrr$!_Limiter__check_all_limits_exemptrr has_hintsrr_Limiter__should_check_backendrcheckrr'rr^ itertoolschainrresolve_limitsrrrWr) r5r blueprint callable_name in_middlewarer view_funcmarked_for_limitingrdefaults decoratedlimitss r6__filter_limitszLimiter.__filter_limitss  D))88<jMd| j&d|jNr|jNg| } | jPr0| |j.jR| <|j"j$}n|j"jT}| j(|d<t+|| j&| d | j,}|jW||| j&g| i|rZ|j>jYd | j&| ||jW| | fd|d _-|d }|j\sn|s*|r(|Dcgc]}|j,r|}}|r|d n|d }|xsd|j._||j._d}|D]}t+||d j&|d d|d j,}t^ja|jb|d jgD]4}|s ||}t5|tj6j8r|}6|rtjg|j|D cgc]*} | d jste| d j,c} Dcgc]}|js|}}|D]g} | j|tjjH}| j} | |g} |j"jT| j&g| itCtE|dd d |ycc}wcc}w#t:$r6}|j<r|j>jAd|n|Yd}~d}~wwxYwcc}w#t:$r6}|j<r|j>jAd|n|Yd}~d}~wwxYwcc} wcc}w)NrTz,on_meta_breach callback failed with error %s)r8c|jSr.r'xs r6rz+Limiter.__evaluate_limits..s r8)r)zSkipping limit: z". Empty value found in parameters.Fz*ratelimit %s (%s) exceeded at endpoint: %srLrrz'on_breach callback failed with error %sc |djS)Nrrirjs r6rz+Limiter.__evaluate_limits..rsAaDJJr8)3r[r\rru is_exemptr!METArexemption_scoperrUrr^r scope_forrtrr:testr'r5r&r,rrRrUrwrappersResponser6rrr7r#sorted method_exemptmethodallerrorrrrVr4rr'r+rr_fromkeysrr^)r5rre failed_limitslimit_for_header view_limitsr' meta_limitrur9 limit_keyrr:rtbreached_meta_limitmeta_breach_response cb_responser; limit_scopekwargsrv request_limitexpliciton_breach_responsecbs r6__evaluate_limitszLimiter.__evaluate_limitss>@ 04*, (oo""17M5;L;L%##M ''        00!!8U]]-D-D  # P#&<<>3==43P5 !5)MMAT-A-A (t||((UTU@T@TU*6tSYYdTWT^T^*_'3FDLL05H4IDLL1+/(  **34G*HK)+u~~7N7NO7B 4,C:NOO/ P2&&78' C}} 1 1--%--2F2FGK I{+DFt9 !!$4SYYK?a"bc((040;? 33C8**)) 11F6N(syy$szzRM   } -#))5d5f5   @II  $$c4[1+/ B(#.r? --O' R K,7K%ellKHK.6x{KN '7'?4 $(3 %!" &E(uQx~~uQxuUVx_MmmT__eAh6H6H$IJ & &&(&7 %k5>>3J3JK1<. & & #,//#&&#:G^33q6K]K]d3q6--.^#"++ K# 3!mmHemm6J6JK LLN !;/    2T2  3 $}*>?B1E+  QN  < )*#33 $ 5 5$RTW!"'* !"*lL$%&// KK112[]`a"%Ib&_ s^U' U' U,.U1V3V39.V8 W: "W: W?1 V0:+V++V08 W7+W22W7c4|j} |j|tjj||}|j ||y#t $r}t|tr||jrf|jsZ|jjdd|_ |jjj|j!||n/|j"r|jj%dn|Yd}~yYd}~yd}~wwxYw)Nr>T)r_r`z&Failed to rate limit. Swallowing error)r1_Limiter__filter_limitsrrr^_Limiter__evaluate_limitsr6rr#rrrr)rrWrYrrr7)r5r_r`r all_limitsrHs r6rzLimiter._check_request_limitvs((* -- '' J  " "8Z 8 !.///8J8J ##X&*" ((..0)) Ub)c''KK))*RSGTd s>A DB.DDc8|jjyr.)rrZ)r5_s r6__release_contextzLimiter.__release_contexts r8):rzCallable[[], str]rbzflask.Flask | Nonercz,list[str | Callable[[], str] | Limit] | Nonerd bool | NonereCallable[[], bool] | Nonerf0Callable[[flask.wrappers.Response], bool] | Nonergint | Callable[[], int] | Nonerhz7list[str | Callable[[], str] | ApplicationLimit] | Nonerirrjrrkrrlrrmrrnzdict[HeaderNames, str] | Nonero str | Nonerprrqzdict[str, str | int] | Nonerrrrsrrt?Callable[[RequestLimit], flask.wrappers.Response | None] | Noneruz0list[str | Callable[[], str] | MetaLimit] | Nonervrrwlist[str] | Nonerxrryrrzr(r{zCallable[..., str] | Noner|r*rErF)rb flask.FlaskrErF)rErP)rstr | Callable[[], str]rCallable[[], str] | Nonerr*rrrstr | Callable[[], str] | Nonerrrr*rrrt?None | Callable[[RequestLimit], flask.wrappers.Response | None]rint | Callable[[], int]rz!str | Callable[[str], str] | Noneru4Sequence[str | Callable[[], str] | MetaLimit] | NonerEr)rrrzstr | Callable[[str], str]rrrr*rrrrrrrr*rrrtrrrrurrEr)r flask.Blueprintr r!rEr)r Callable[..., R]r r!rEr)r r!rEzYCallable[[Callable[P, R]], Callable[P, R]] | Callable[[flask.Blueprint], flask.Blueprint]r.)r z)Callable[..., R] | flask.Blueprint | Noner r!rEz~Callable[..., R] | flask.Blueprint | Callable[[Callable[P, R]], Callable[P, R]] | Callable[[flask.Blueprint], flask.Blueprint])rCallable[[], bool]rEr)rbrror(rErF)rEr*r[)rEr rG)rErQ)rErT)rEr()r8flask.wrappers.ResponserErF)r8rrEr)rrrEr*)F) rrr^rr_rr`r*rElist[RuntimeLimit])rr(rerrErF)NT)r_rr`r*rErF)rzBaseException | NonerErF) rHrIrJrKr7rrMrr'rrr! APPLICATIONDEFAULTrnrrrrYrZr&r:r-r/r1r?rrWrrrrrNr8r6rDrDxso;B#'GK15@DW[>BVZ59DH[_BF'+=A#"&7;&*,0UYHLZ^/326"&8<=N#N N E N $/ N%>N%UN<NTN(3N)BN)YN"@N%N ;!N"#N$ %N&5'N($)N**+N,S-N.F/N0X1N2-3N4%05N6 7N89N:6;N<=N> ?N`j X,.2 $(8<15"&HLW[()37LPL ,L + L  L " L 6L /L  L FL UL &L 1L JL  L f.2 $(8<15"&HLW[()LP; ,; *; + ;  ; "; 6; /;  ; F; U; &; J;  ; z !/ : :  !!   !     !/ : :  !!   !    !/ : :  !!   !   b  :>9!/ : :  !!   ! 9 69 9 79v R. R  ,,4--  "<|       $ ......" ..  ..  ..`AHGK'?C :r8rD)@rK __future__rr\rBrr[rrrr/ collectionsrrtypingrrflask.wrappersrerr limits.errorsr limits.storager r r limits.strategiesr r ordered_setr werkzeug.httprr_compatr_limitsrrrrr_managerr_typingrrrrr constantsrr r!r"errorsr#utilr$r& dataclassrPrDrNr8r6rs# # -,FF5"/$#SR%$66r  ! ! !\\r8